Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c-type heme lyase (HCCS)

Product Specifications

Product Name Alternative

Holocytochrome c-type synthase

Abbreviation

Recombinant Human HCCS protein

Gene Name

HCCS

UniProt

P53701

Expression Region

1-268aa

Organism

Homo sapiens (Human)

Target Sequence

MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Links covalently the heme group to the apoprotein of cytochrome c.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Links covalently the heme group to the apoprotein of cytochrome c.

Molecular Weight

57.6 kDa

References & Citations

"Genomic structure of a human holocytochrome c-type synthetase gene in Xp22.3 and mutation analysis in patients with Rett syndrome." van den Veyver I.B., Subramanian S., Zoghbi H.Y. Am. J. Med. Genet. 78:179-181 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAP30BP AAV siRNA Pooled Vector
43013161 1.0 µg

SAP30BP AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Hp-IgM-Ab (Hp-IgM-Ab) ELISA Kit
YP-W24722-01 48 Tests

Mouse Hp-IgM-Ab (Hp-IgM-Ab) ELISA Kit

Sign In for Pricing
View Details
Mouse Hp-IgM-Ab (Hp-IgM-Ab) ELISA Kit
YP-W24722-02 96 Tests

Mouse Hp-IgM-Ab (Hp-IgM-Ab) ELISA Kit

Sign In for Pricing
View Details
Rat rno-miR-761 miRNA Antagomir
abx890112-01 10 nmol

Rat rno-miR-761 miRNA Antagomir

Sign In for Pricing
View Details
Rat rno-miR-761 miRNA Antagomir
abx890112-02 20 nmol

Rat rno-miR-761 miRNA Antagomir

Sign In for Pricing
View Details
LGX 818 25mg
A13226-25 25 mg

LGX 818 25mg

Sign In for Pricing
View Details