Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ADAMTS-like protein 2 (ADAMTSL2), partial

Product Specifications

Product Name Alternative

(ADAMTSL-2)

Abbreviation

Recombinant Human ADAMTSL2 protein, partial

Gene Name

ADAMTSL2

UniProt

Q86TH1

Expression Region

861-943aa

Organism

Homo sapiens (Human)

Target Sequence

PWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Developmental Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.5 kDa

References & Citations

"A strategy for precise and la

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cal-630™, potassium salt
20538-AAT 5x 50 µg

Cal-630™, potassium salt

Sign In for Pricing
View Details
Recombinant Human PPIase/FKBP7 Protein (aa 1-218, His Tag)
PKSH030674 100 µg

Recombinant Human PPIase/FKBP7 Protein (aa 1-218, His Tag)

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF594 conjugate, 0.1mg/mL
BNC941531-100 1x 100 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Multi Angle Spectrophotometer BMAS-1202
BMAS-1202 1 Unit

Multi Angle Spectrophotometer BMAS-1202

Sign In for Pricing
View Details
Lambda Light Chain (B-Cell Marker) (rLLC/1738), CF568 conjugate, 0.1mg/mL
BNC683773-100 1x 100 µL

Lambda Light Chain (B-Cell Marker) (rLLC/1738), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF488A conjugate, 0.1mg/mL
BNC881284-100 1x 100 µL

CD11c (Dendritic Cell Marker) (ITGAX/1284), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details