Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Elongation factor 1-beta (EEF1B2)

Product Specifications

Product Name Alternative

EEF1B; EEF1B1; EEF1B2; EF-1-beta; EF1B; EF1B_HUMAN; Elongation factor 1; beta-2-A; Elongation factor 1-beta; eukaryotic translation elongation factor 1 beta 1; eukaryotic translation elongation factor 1 beta 2

Abbreviation

Recombinant Human EEF1B2 protein

Gene Name

EEF1B2

UniProt

P24534

Expression Region

1-225aa

Organism

Homo sapiens (Human)

Target Sequence

MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.

Molecular Weight

51.8 kDa

References & Citations

"Human elongation factor 1 beta: cDNA and derived amino acid sequence." von der Kammer H., Klaudiny J., Zimmer M., Scheit K.H. Biochem. Biophys. Res. Commun. 177:312-317 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF 279
sc-202730 10 mg

NF 279

Sign In for Pricing
View Details
Ring Finger Protein 8 (RNF8) Antibody
abx034530-01 80 µL

Ring Finger Protein 8 (RNF8) Antibody

Sign In for Pricing
View Details
Ring Finger Protein 8 (RNF8) Antibody
abx034530-02 400 µL

Ring Finger Protein 8 (RNF8) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Cyclin A1 Antibody (XLA1-3) [Janelia Fluor 549]
NBP2-50188JF549 0.1 mL

Mouse Monoclonal Cyclin A1 Antibody (XLA1-3) [Janelia Fluor 549]

Sign In for Pricing
View Details
LAPTM4B (NM_018407) Human Over-expression Lysate
LS055353 100 µg

LAPTM4B (NM_018407) Human Over-expression Lysate

Sign In for Pricing
View Details
Cleaved Caspase-8 (Asp387) Antibody
CST 9429S 100 µL

Cleaved Caspase-8 (Asp387) Antibody

Sign In for Pricing
View Details