Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Elongation factor 1-beta (EEF1B2)

Product Specifications

Product Name Alternative

EEF1B; EEF1B1; EEF1B2; EF-1-beta; EF1B; EF1B_HUMAN; Elongation factor 1; beta-2-A; Elongation factor 1-beta; eukaryotic translation elongation factor 1 beta 1; eukaryotic translation elongation factor 1 beta 2

Abbreviation

Recombinant Human EEF1B2 protein

Gene Name

EEF1B2

UniProt

P24534

Expression Region

1-225aa

Organism

Homo sapiens (Human)

Target Sequence

MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.

Molecular Weight

51.8 kDa

References & Citations

"Human elongation factor 1 beta: cDNA and derived amino acid sequence." von der Kammer H., Klaudiny J., Zimmer M., Scheit K.H. Biochem. Biophys. Res. Commun. 177:312-317 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTAGE7P ORF Vector (Human) (pORF)
17034011 1.0 µg DNA

CTAGE7P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TCEB3C sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2348305 3x 1.0 µg

TCEB3C sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (MaxLight 650)
MBS6227835-01 0.1 mL

GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (MaxLight 650)

Sign In for Pricing
View Details
GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (MaxLight 650)
MBS6227835-02 5x 0.1 mL

GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit anti-human Intestinal-type alkaline phosphatase polyclonal Antibody
MBS7004409-01 0.05 mg

Rabbit anti-human Intestinal-type alkaline phosphatase polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Intestinal-type alkaline phosphatase polyclonal Antibody
MBS7004409-02 0.1 mg

Rabbit anti-human Intestinal-type alkaline phosphatase polyclonal Antibody

Sign In for Pricing
View Details