Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Astrocytic phosphoprotein PEA-15 (PEA15)

Product Specifications

Product Name Alternative

15KDA phosphoprotein enriched in astrocytes Phosphoprotein enriched in diabetes

Abbreviation

Recombinant Human PEA15 protein

Gene Name

PEA15

UniProt

Q15121

Expression Region

1-130aa

Organism

Homo sapiens (Human)

Target Sequence

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm. Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm (By similarity) . Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface.

Molecular Weight

42 kDa

References & Citations

"The major astrocytic phosphoprotein PEA-15 is encoded by two mRNAs conserved on their full length in mouse and human." Estelles A., Yokoyama M., Nothias F., Vincent J.-D., Glowinski J., Vernier P., Chneiweiss H. J. Biol. Chem. 271:14800-14806 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Cyclopropyl-8-ethoxy-6,7-difluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl Ester-d5
TRC-C988507-5MG 5 mg

1-Cyclopropyl-8-ethoxy-6,7-difluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl Ester-d5

Sign In for Pricing
View Details
CD99 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C1]
TA800788AM 100 µL

CD99 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C1]

Sign In for Pricing
View Details
PAIP2 (NM_001033112) Human Over-expression Lysate
LY422367 100 µg

PAIP2 (NM_001033112) Human Over-expression Lysate

Sign In for Pricing
View Details
GTF3A Rabbit Polyclonal Antibody
TA361810 100 µL

GTF3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX21 Mouse Monoclonal Antibody [Clone ID: OTI7D5]
CF807817 100 µg

SOX21 Mouse Monoclonal Antibody [Clone ID: OTI7D5]

Sign In for Pricing
View Details
Guthoxon
TRC-G855650-10MG 10 mg

Guthoxon

Sign In for Pricing
View Details