Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ketohexokinase (KHK)

Product Specifications

Product Name Alternative

Hepatic fructokinase

Abbreviation

Recombinant Human KHK protein

Gene Name

KHK

UniProt

P50053

Expression Region

1-298aa

Organism

Homo sapiens (Human)

Target Sequence

MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.

Molecular Weight

59.7 kDa

References & Citations

"An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome." Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H. J. Proteomics 96:253-262 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound NP-024276
T128111-01 10 mg

Compound NP-024276

Sign In for Pricing
View Details
Compound NP-024276
T128111-02 1 g

Compound NP-024276

Sign In for Pricing
View Details
Compound NP-024276
T128111-03 1 mg

Compound NP-024276

Sign In for Pricing
View Details
Compound NP-024276
T128111-04 50 mg

Compound NP-024276

Sign In for Pricing
View Details
Compound NP-024276
T128111-05 5 mg

Compound NP-024276

Sign In for Pricing
View Details
LIG4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
26519066 1.0 µg DNA

LIG4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details