Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-31 (RAB31)

Product Specifications

Product Name Alternative

Ras-related protein Rab-22B

Abbreviation

Recombinant Human RAB31 protein

Gene Name

RAB31

UniProt

Q13636

Expression Region

1-194aa

Organism

Homo sapiens (Human)

Target Sequence

MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.

Molecular Weight

48.6 kDa

References & Citations

"Molecular cloning of two novel rab genes from human melanocytes." Chen D., Guo J., Miki T., Tachibana M., Gahl W.A. Gene 174:129-134 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal IL6R Antibody (OTI2F4) [DyLight 350]
NBP2-71029UV 0.1 mL

Mouse Monoclonal IL6R Antibody (OTI2F4) [DyLight 350]

Ask
View Details
DNA-PKCS (Phospho Ser2612) Polyclonal Antibody
MBS9459087-01 0.05 mL

DNA-PKCS (Phospho Ser2612) Polyclonal Antibody

Ask
View Details
DNA-PKCS (Phospho Ser2612) Polyclonal Antibody
MBS9459087-02 0.1 mL

DNA-PKCS (Phospho Ser2612) Polyclonal Antibody

Ask
View Details
DNA-PKCS (Phospho Ser2612) Polyclonal Antibody
MBS9459087-03 5x 0.1 mL

DNA-PKCS (Phospho Ser2612) Polyclonal Antibody

Ask
View Details
Chloramphenicol 10mM * 1mL in DMSO
A10200-10mM-D 10 mM x 1mL in DMSO

Chloramphenicol 10mM * 1mL in DMSO

Ask
View Details
Vacuolar protein sorting-associated protein 13A (VPS13A) Human ELISA Kit
I1818 96 Tests

Vacuolar protein sorting-associated protein 13A (VPS13A) Human ELISA Kit

Ask
View Details