Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription initiation factor IIA subunit 2 (GTF2A2)

Product Specifications

Product Name Alternative

General transcription factor IIA subunit 2 TFIIA p12 subunit

Abbreviation

Recombinant Human GTF2A2 protein

Gene Name

GTF2A2

UniProt

P52657

Expression Region

1-109aa

Organism

Homo sapiens (Human)

Target Sequence

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Molecular Weight

39.5 kDa

References & Citations

"Reconstitution of human TFIIA activity from recombinant polypeptides: a role in TFIID-mediated transcription." Sun X., Ma D., Sheldon M., Yeung K., Reinberg D. Genes Dev. 8:2336-2348 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGD5 Polyclonal Antibody
E-AB-66464-01 60 µL

FGD5 Polyclonal Antibody

Sign In for Pricing
View Details
FGD5 Polyclonal Antibody
E-AB-66464-02 120 µL

FGD5 Polyclonal Antibody

Sign In for Pricing
View Details
FGD5 Polyclonal Antibody
E-AB-66464-03 200 µL

FGD5 Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF488A conjugate, 0.1mg/mL
BNC882958-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
H3.3B (H3F3B) (NM_005324) Human Over-expression Lysate
LC401642 20 µg

H3.3B (H3F3B) (NM_005324) Human Over-expression Lysate

Sign In for Pricing
View Details
Goat anti-Rabbit IgG Coated - 96 well Solid plates - White PS
MCW26F-aR/W 10x 96 Well Plates

Goat anti-Rabbit IgG Coated - 96 well Solid plates - White PS

Sign In for Pricing
View Details