Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription initiation factor IIA subunit 2 (GTF2A2)

Product Specifications

Product Name Alternative

General transcription factor IIA subunit 2 TFIIA p12 subunit

Abbreviation

Recombinant Human GTF2A2 protein

Gene Name

GTF2A2

UniProt

P52657

Expression Region

1-109aa

Organism

Homo sapiens (Human)

Target Sequence

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Molecular Weight

39.5 kDa

References & Citations

"Reconstitution of human TFIIA activity from recombinant polypeptides: a role in TFIID-mediated transcription." Sun X., Ma D., Sheldon M., Yeung K., Reinberg D. Genes Dev. 8:2336-2348 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Aminopyrimidine-5-carboxylic Acid Ethyl Ester
TRC-A629105-5G 5 g

4-Aminopyrimidine-5-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
Uncoated Human TSP-1 (Thrombospondin-1) ELISA Kit
E-UNEL-H0160-01 5x 96 Tests

Uncoated Human TSP-1 (Thrombospondin-1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TSP-1 (Thrombospondin-1) ELISA Kit
E-UNEL-H0160-02 15x 96 Tests

Uncoated Human TSP-1 (Thrombospondin-1) ELISA Kit

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL
BNC400461-500 1x 500 µL

Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEIS1 Mouse Monoclonal Antibody [Clone ID: OTI1B4]
CF809622 100 µg

MEIS1 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

Sign In for Pricing
View Details
PP5 (PPP5C) Human Gene Knockout Kit (CRISPR)
KN401650 1 Kit

PP5 (PPP5C) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details