Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LIM domain transcription factor LMO4 (LMO4)

Product Specifications

Product Name Alternative

Breast tumor autoantigen LIM domain only protein 4

Abbreviation

Recombinant Human LMO4 protein

Gene Name

LMO4

UniProt

P61968

Expression Region

1-165aa

Organism

Homo sapiens (Human)

Target Sequence

MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Probable transcriptional factor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable transcriptional factor.

Molecular Weight

45 kDa

References & Citations

"Molecular cloning of LMO4, a new human LIM domain gene." Racevskis J., Dill A., Sparano J.A., Ruan H. Biochim. Biophys. Acta 1445:148-153 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)
MBS1181533-01 0.02 mg (E-Coli)

Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)
MBS1181533-02 0.1 mg (E-Coli)

Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)
MBS1181533-03 0.02 mg (Yeast)

Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)
MBS1181533-04 0.1 mg (Yeast)

Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)
MBS1181533-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)
MBS1181533-06 1 mg (E-Coli)

Recombinant Pseudomonas fluorescens DNA gyrase inhibitor YacG (yacG)

Sign In for Pricing
View Details