Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thioredoxin-like protein 4B (TXNL4B)

Product Specifications

Product Name Alternative

Dim1-like protein

Abbreviation

Recombinant Human TXNL4B protein

Gene Name

TXNL4B

UniProt

Q9NX01

Expression Region

1-149aa

Organism

Homo sapiens (Human)

Target Sequence

MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G2 transition.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G (2) transition.

Molecular Weight

44 kDa

References & Citations

"DLP, a novel Dim1 family protein implicated in pre-mRNA splicing and cell cycle progression." Sun X., Zhang H., Wang D., Ma D., Shen Y., Shang Y. J. Biol. Chem. 279:32839-32847 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmed10 Mouse Gene Knockout Kit (CRISPR)
KN517677 1 Kit

Tmed10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Crip2 Mouse Gene Knockout Kit (CRISPR)
KN503827 1 Kit

Crip2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OptiWell™ Sealing Mats for DW Plates
D3320-3 50 Units/Pack

OptiWell™ Sealing Mats for DW Plates

Sign In for Pricing
View Details
AGO3 Recombinant Rabbit Monoclonal Antibody [JJ201-07]
ET1701-26 100 µL

AGO3 Recombinant Rabbit Monoclonal Antibody [JJ201-07]

Sign In for Pricing
View Details
IgM Immunoglobulin (Cocktail), Biotin conjugate, 0.1mg/mL
BNCB0762-500 1x 500 µL

IgM Immunoglobulin (Cocktail), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB521054 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details