Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TP53-regulated inhibitor of apoptosis 1 (TRIAP1)

Product Specifications

Product Name Alternative

Protein 15E1.1 WF-1 p53-inducible cell-survival factor

Abbreviation

Recombinant Human TRIAP1 protein

Gene Name

TRIAP1

UniProt

O43715

Expression Region

1-76aa

Organism

Homo sapiens (Human)

Target Sequence

MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo) . Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1

Molecular Weight

35.8 kDa

References & Citations

"p53CSV, a novel p53-inducible gene involved in the p53-dependent cell-survival pathway." Park W.-R., Nakamura Y. Cancer Res. 65:1197-1206 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4A3-IN-7
MF-0152800 5 mg

EIF4A3-IN-7

Sign In for Pricing
View Details
Camel Netrin 4 ELISA Kit
MBS060457-01 48 Well

Camel Netrin 4 ELISA Kit

Sign In for Pricing
View Details
Camel Netrin 4 ELISA Kit
MBS060457-02 96 Well

Camel Netrin 4 ELISA Kit

Sign In for Pricing
View Details
Camel Netrin 4 ELISA Kit
MBS060457-03 5x 96 Well

Camel Netrin 4 ELISA Kit

Sign In for Pricing
View Details
Camel Netrin 4 ELISA Kit
MBS060457-04 10x 96 Well

Camel Netrin 4 ELISA Kit

Sign In for Pricing
View Details
Plant Myosin Heavy Chain (MHC) ELISA Kit
MBS9377940 Inquire

Plant Myosin Heavy Chain (MHC) ELISA Kit

Sign In for Pricing
View Details