Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial fission process protein 1 (MTFP1)

Product Specifications

Product Name Alternative

Mitochondrial 18KDA protein

Abbreviation

Recombinant Human MTFP1 protein

Gene Name

MTFP1

UniProt

Q9UDX5

Expression Region

1-166aa

Organism

Homo sapiens (Human)

Target Sequence

MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis.

Molecular Weight

45 kDa

References & Citations

"A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBLCP1 Polyclonal Antibody
E-AB-18300-01 20 µL

UBLCP1 Polyclonal Antibody

Sign In for Pricing
View Details
UBLCP1 Polyclonal Antibody
E-AB-18300-02 60 µL

UBLCP1 Polyclonal Antibody

Sign In for Pricing
View Details
UBLCP1 Polyclonal Antibody
E-AB-18300-03 120 µL

UBLCP1 Polyclonal Antibody

Sign In for Pricing
View Details
UBLCP1 Polyclonal Antibody
E-AB-18300-04 200 µL

UBLCP1 Polyclonal Antibody

Sign In for Pricing
View Details
MIF Recombinant Rabbit Monoclonal Antibody [JM11-64]
ET1703-89 100 µL

MIF Recombinant Rabbit Monoclonal Antibody [JM11-64]

Sign In for Pricing
View Details
BFAR (N-term) Rabbit Polyclonal Antibody
AP50370PU-N 400 µL

BFAR (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details