Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Visinin-like protein 1 (VSNL1)

Product Specifications

Product Name Alternative

Hippocalcin-like protein 3

Abbreviation

Recombinant Human VSNL1 protein

Gene Name

VSNL1

UniProt

P62760

Expression Region

1-191aa

Organism

Homo sapiens (Human)

Target Sequence

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Regulates the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.

Molecular Weight

49 kDa

References & Citations

"Peptide conservation between avian and mammalian visinin-like proteins." Bellingham J. Submitted (DEC-1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-100 1x 100 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-500 1x 500 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details