Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Regulator of G-protein signaling 5 (RGS5)

Product Specifications

Product Name Alternative

MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129; Regulator of G Protein Signalling 5; Regulator of G-protein signaling 5; RGS 5; RGS5; RGS5_HUMAN

Abbreviation

Recombinant Human RGS5 protein

Gene Name

RGS5

UniProt

O15539

Expression Region

1-181aa

Organism

Homo sapiens (Human)

Target Sequence

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G (i) -alpha and G (o) -alpha, but not to G (s) -alpha

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G (i) -alpha and G (o) -alpha, but not to G (s) -alpha (By similarity) .

Molecular Weight

47.9 kDa

References & Citations

"Genetic screens in yeast to identify mammalian nonreceptor modulators of G-protein signaling." Cismowski M.J., Takesono A., Ma C., Lizano J.S., Xie X., Fuernkranz H., Lanier S.M., Duzic E. Nat. Biotechnol. 17:878-883 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrsam1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4858004 1.0 µg DNA

Lrsam1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ZIC4 siRNA Oligos set (Human)
51248171 3x 5 nmol

ZIC4 siRNA Oligos set (Human)

Sign In for Pricing
View Details
EGFR Rabbit Monoclonal Antibody [KD Validation]
E51K69236 40 µL

EGFR Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Biomimicking fish-tail soft stirring disc for 0.4, 1, 3 and 7 l reactor, diam. 60mm
800033-f 1 Piece

Biomimicking fish-tail soft stirring disc for 0.4, 1, 3 and 7 l reactor, diam. 60mm

Sign In for Pricing
View Details
Recombinant Acid Phosphatase 6, Lysophosphatidic (ACP6)
SIPD058Ra01-01 10 µg

Recombinant Acid Phosphatase 6, Lysophosphatidic (ACP6)

Sign In for Pricing
View Details
Recombinant Acid Phosphatase 6, Lysophosphatidic (ACP6)
SIPD058Ra01-02 50 µg

Recombinant Acid Phosphatase 6, Lysophosphatidic (ACP6)

Sign In for Pricing
View Details