Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H3.1 (HIST1H3A)

Product Specifications

Product Name Alternative

Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l

Abbreviation

Recombinant Human HIST1H3A protein

Gene Name

HIST1H3A

UniProt

P68431

Expression Region

1-136aa

Organism

Homo sapiens (Human)

Target Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Molecular Weight

42.3 kDa

References & Citations

"The primary structure and expression of four cloned human histone genes." Zhong R., Roeder R.G., Heintz N. Nucleic Acids Res. 11:7409-7425 (1983)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NRP2 Human siRNA Oligo Duplex (Locus ID 8828)
SR305825 1 Kit

NRP2 Human siRNA Oligo Duplex (Locus ID 8828)

Ask
View Details
WHAMMP1 siRNA Oligos set (Human)
50418171 3x 5 nmol

WHAMMP1 siRNA Oligos set (Human)

Ask
View Details
Rabbit Olfactory receptor 6C70 (OR6C70) ELISA Kit
MBS7225790-01 48 Well

Rabbit Olfactory receptor 6C70 (OR6C70) ELISA Kit

Ask
View Details
Rabbit Olfactory receptor 6C70 (OR6C70) ELISA Kit
MBS7225790-02 96 Well

Rabbit Olfactory receptor 6C70 (OR6C70) ELISA Kit

Ask
View Details
Rabbit Olfactory receptor 6C70 (OR6C70) ELISA Kit
MBS7225790-03 5x 96 Well

Rabbit Olfactory receptor 6C70 (OR6C70) ELISA Kit

Ask
View Details
Rabbit Olfactory receptor 6C70 (OR6C70) ELISA Kit
MBS7225790-04 10x 96 Well

Rabbit Olfactory receptor 6C70 (OR6C70) ELISA Kit

Ask
View Details