Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UPF0468 protein C16orf80 (C16orf80)

Product Specifications

Product Name Alternative

Basal body up-regulated protein 22 Transcription factor IIB

Abbreviation

Recombinant Human C16orf80 protein

Gene Name

C16orf80

UniProt

Q9Y6A4

Expression Region

1-193aa

Organism

Homo sapiens (Human)

Target Sequence

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia

Molecular Weight

49.8 kDa

References & Citations

"Bug22p, a conserved centrosomal/ciliary protein also present in higher plants, is required for an effective ciliary stroke in Paramecium." Laligne C., Klotz C., de Loubresse N.G., Lemullois M., Hori M., Laurent F.X., Papon J.F., Louis B., Cohen J., Koll F. Eukaryot. Cell 9:645-655 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)
MBS1424238-01 0.02 mg (E-Coli)

Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)

Sign In for Pricing
View Details
Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)
MBS1424238-02 0.02 mg (Yeast)

Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)

Sign In for Pricing
View Details
Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)
MBS1424238-03 0.1 mg (E-Coli)

Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)

Sign In for Pricing
View Details
Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)
MBS1424238-04 0.1 mg (Yeast)

Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)

Sign In for Pricing
View Details
Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)
MBS1424238-05 0.02 mg (Baculovirus)

Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)

Sign In for Pricing
View Details
Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)
MBS1424238-06 0.02 mg (Mammalian-Cell)

Recombinant Takifugu rubripes Homeobox protein Hox-B1a (hoxb1a)

Sign In for Pricing
View Details