Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mannose-6-phosphate isomerase (MPI)

Product Specifications

Product Name Alternative

Phosphohexomutase Phosphomannose isomerase

Abbreviation

Recombinant Human MPI protein

Gene Name

MPI

UniProt

P34949

Expression Region

1-423aa

Organism

Homo sapiens (Human)

Target Sequence

AAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.

Molecular Weight

73.5 kDa

References & Citations

"Genomic organization of the human phosphomannose isomerase (MPI) gene and mutation analysis in patients with congenital disorders of glycosylation type Ib (CDG-Ib) ." Schollen E., Dorland L., de Koning T.J., Van Diggelen O.P., Huijmans J.G.M., Marquardt T., Babovic-Vuksanovic D., Patterson M., Imtiaz F., Winchester B., Adamowicz M., Pronicka E., Freeze H., Matthijs G. Hum. Mutat. 16:247-252 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat LGALS1 shRNA Plasmid
abx985864-01 150 µg

Rat LGALS1 shRNA Plasmid

Sign In for Pricing
View Details
Rat LGALS1 shRNA Plasmid
abx985864-02 300 µg

Rat LGALS1 shRNA Plasmid

Sign In for Pricing
View Details
1110008F13Rik 3'UTR Luciferase Stable Cell Line
TU100034 1.0 mL

1110008F13Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Sulbactam-d5 Sodium Salt (Major)
TRC-S699187-10MG 10 mg

Sulbactam-d5 Sodium Salt (Major)

Sign In for Pricing
View Details
Mouse Monoclonal Mxi1 Antibody (PCRP-MXI1-1A3) [PE]
NBP3-08353PE 100 µL

Mouse Monoclonal Mxi1 Antibody (PCRP-MXI1-1A3) [PE]

Sign In for Pricing
View Details
Lentiviral human HGH1 shRNA (UAS) - Lentiviral human HGH1 shRNA (UAS, GFP) plasmid
GTR15159166 1 Vial

Lentiviral human HGH1 shRNA (UAS) - Lentiviral human HGH1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details