Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MARCKS-related protein (MARCKSL1)

Product Specifications

Product Name Alternative

MARCKS-like protein 1 Macrophage myristoylated alanine-rich C kinase substrate

Abbreviation

Recombinant Human MARCKSL1 protein

Gene Name

MARCKSL1

UniProt

P49006

Expression Region

1-195aa

Organism

Homo sapiens (Human)

Target Sequence

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Controls cell movement by regulating actin cytoskeleton homeostasis and filopodium and lamellipodium formation. When unphosphorylated, induces cell migration. When phosphorylated by MAPK8, induces actin bundles formation and stabilization, thereby reducing actin plasticity, hence restricting cell movement, including neuronal migration. May also affect cancer cell migration. May be involved in coupling the protein kinase C and calmodulin signal transduction systems

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Controls cell movement by regulating actin cytoskeleton homeostasis and filopodium and lamellipodium formation. When unphosphorylated, induces cell migration. When phosphorylated by MAPK8, induces actin bundles formation and stabilization, thereby reducing actin plasticity, hence restricting cell movement, including neuronal migration. May also affect cancer cell migration. May be involved in coupling the protein kinase C and calmodulin signal transduction systems (By similarity) .

Molecular Weight

46.5 kDa

References & Citations

"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of BC066915

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NFE2L3 (NM_004289) Human Tagged Lenti ORF Clone
RC209720L3 10 µg

NFE2L3 (NM_004289) Human Tagged Lenti ORF Clone

Ask
View Details
CD21 (CR2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D3]
TA814107BM 100 µL

CD21 (CR2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D3]

Ask
View Details
Phospho-RPS6KA5 (S360) Antibody
A42446-50UG 50 µg

Phospho-RPS6KA5 (S360) Antibody

Ask
View Details
Rat CREB/ATF bZIP transcription factor (CREBZF) ELISA Kit
MBS7252924-01 48 Well

Rat CREB/ATF bZIP transcription factor (CREBZF) ELISA Kit

Ask
View Details
Rat CREB/ATF bZIP transcription factor (CREBZF) ELISA Kit
MBS7252924-02 96 Well

Rat CREB/ATF bZIP transcription factor (CREBZF) ELISA Kit

Ask
View Details
Rat CREB/ATF bZIP transcription factor (CREBZF) ELISA Kit
MBS7252924-03 5x 96 Well

Rat CREB/ATF bZIP transcription factor (CREBZF) ELISA Kit

Ask
View Details