Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human mRNA export factor (RAE1)

Product Specifications

Product Name Alternative

Rae1 protein homolog mRNA-associated protein mrnp 41

Abbreviation

Recombinant Human RAE1 protein

Gene Name

RAE1

UniProt

P78406

Expression Region

1-368aa

Organism

Homo sapiens (Human)

Target Sequence

MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in mitotic bipolar spindle formation

Molecular Weight

68 kDa

References & Citations

"The human RAE1 gene is a functional homologue of Schizosaccharomyces pombe rae1 gene involved in nuclear export of poly (A) + RNA." Bharathi A., Ghosh A., Whalen W.A., Yoon J.H., Pu R., Dasso M., Dhar R. Gene 198:251-258 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNAP25 Antibody
orb1281016 100 µL

SNAP25 Antibody

Sign In for Pricing
View Details
Anti-Aquaporin 0 Antibody
CPA1740-01 30 µL

Anti-Aquaporin 0 Antibody

Sign In for Pricing
View Details
Anti-Aquaporin 0 Antibody
CPA1740-02 50 μL

Anti-Aquaporin 0 Antibody

Sign In for Pricing
View Details
Anti-Aquaporin 0 Antibody
CPA1740-03 100 µL

Anti-Aquaporin 0 Antibody

Sign In for Pricing
View Details
Anti-Aquaporin 0 Antibody
CPA1740-04 200 µL

Anti-Aquaporin 0 Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli Diaminopimelate epimerase (dapF)
MBS1124153-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Diaminopimelate epimerase (dapF)

Sign In for Pricing
View Details