Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 14 (FGF14)

Product Specifications

Product Name Alternative

Fibroblast growth factor homologous factor 4

Abbreviation

Recombinant Human FGF14 protein

Gene Name

FGF14

UniProt

Q92915

Expression Region

1-252aa

Organism

Homo sapiens (Human)

Target Sequence

MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Probably involved in nervous system development and function.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probably involved in nervous system development and function.

Molecular Weight

55.5 kDa

References & Citations

"Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development." Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J. Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zc3h12b Mouse Gene Knockout Kit (CRISPR)
KN519637 1 Kit

Zc3h12b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Synaptophysin (SYP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A10]
TA506507BM 100 µL

Synaptophysin (SYP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A10]

Sign In for Pricing
View Details
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
AP06066PU-N 100 µg

Claudin 5 (CLDN5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Accuris qMAX Green, qPCR mix with blue tracking dye, Low Rox qPCR Mix, 1000 reactions
PR2000-L-1000 1 Each

Accuris qMAX Green, qPCR mix with blue tracking dye, Low Rox qPCR Mix, 1000 reactions

Sign In for Pricing
View Details
DPH2 Human Gene Knockout Kit (CRISPR)
KN201382RB 1 Kit

DPH2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CCL7 Antibody
KC-1575-01 50 μL

CCL7 Antibody

Sign In for Pricing
View Details