Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 14 (FGF14)

Product Specifications

Product Name Alternative

Fibroblast growth factor homologous factor 4

Abbreviation

Recombinant Human FGF14 protein

Gene Name

FGF14

UniProt

Q92915

Expression Region

1-252aa

Organism

Homo sapiens (Human)

Target Sequence

MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Probably involved in nervous system development and function.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probably involved in nervous system development and function.

Molecular Weight

55.5 kDa

References & Citations

"Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development." Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J. Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Levomepromazine EP Impurity D
TRC-L439310-2.5MG 2.5 mg

Levomepromazine EP Impurity D

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS700825 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
RPL27A (NM_000990) Human Over-expression Lysate
LC400357 20 µg

RPL27A (NM_000990) Human Over-expression Lysate

Sign In for Pricing
View Details
TMA16 Antibody
KC-22132-01 50 μL

TMA16 Antibody

Sign In for Pricing
View Details
TMA16 Antibody
KC-22132-02 100 µL

TMA16 Antibody

Sign In for Pricing
View Details
TMA16 Antibody
KC-22132-03 1 mL

TMA16 Antibody

Sign In for Pricing
View Details