Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acidic mammalian chitinase (CHIA)

Product Specifications

Product Name Alternative

Lung-specific protein TSA1902

Abbreviation

Recombinant Human CHIA protein

Gene Name

CHIA

UniProt

Q9BZP6

Expression Region

1-368aa

Organism

Homo sapiens (Human)

Target Sequence

MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding.

Molecular Weight

67.1 kDa

References & Citations

"Isolation and mapping of a human lung-specific gene, TSA1902, encoding a novel chitinase family member." Saito A., Ozaki K., Fujiwara T., Nakamura Y., Tanigami A. Gene 239:325-331 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-FOXO3A (Ser318/Ser321) Antibody
MBS9612840-01 0.1 mL

Phospho-FOXO3A (Ser318/Ser321) Antibody

Sign In for Pricing
View Details
Phospho-FOXO3A (Ser318/Ser321) Antibody
MBS9612840-02 0.2 mL

Phospho-FOXO3A (Ser318/Ser321) Antibody

Sign In for Pricing
View Details
Phospho-FOXO3A (Ser318/Ser321) Antibody
MBS9612840-03 5x 0.2 mL

Phospho-FOXO3A (Ser318/Ser321) Antibody

Sign In for Pricing
View Details
Non-human Primate IL-4 ELISA Kit
NBP3-11724 1 Kit (1 Plate)

Non-human Primate IL-4 ELISA Kit

Sign In for Pricing
View Details
ACTN1, 1-249aa, Human, His tag, E.coli
E53A01049 50 µg

ACTN1, 1-249aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Dextran (Technical Grade~ 20K)
TRC-D299115-50G 50 g

Dextran (Technical Grade~ 20K)

Sign In for Pricing
View Details