Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pyridoxal kinase (PDXK)

Product Specifications

Product Name Alternative

Pyridoxine kinase

Abbreviation

Recombinant Human PDXK protein

Gene Name

PDXK

UniProt

O00764

Expression Region

1-312aa

Organism

Homo sapiens (Human)

Target Sequence

MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Required for synthesis of pyridoxal-5-phosphate from vitamin B6.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for synthesis of pyridoxal-5-phosphate from vitamin B6.

Molecular Weight

62.1 kDa

References & Citations

"Human pyridoxal kinase. cDNA cloning, expression, and modulation by ligands of the benzodiazepine receptor." Hanna M.C., Turner A.J., Kirkness E.F. J. Biol. Chem. 272:10756-10760 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-500 1x 500 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FSH beta (FSHb/1062), CF740 conjugate, 0.1mg/mL
BNC741062-100 1x 100 µL

FSH beta (FSHb/1062), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF647 conjugate, 0.1mg/mL
BNC472400-100 1x 100 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), CF568 conjugate, 0.1mg/mL
BNC680685-500 1x 500 µL

CD68 (C68/684 + KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details