Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial carnitine/acylcarnitine carrier protein (SLC25A20)

Product Specifications

Product Name Alternative

Carnitine/acylcarnitine translocase

Abbreviation

Recombinant Human SLC25A20 protein

Gene Name

SLC25A20

UniProt

O43772

Expression Region

1-301aa

Organism

Homo sapiens (Human)

Target Sequence

MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.

Molecular Weight

59.9 kDa

References & Citations

"The structure and organization of the human carnitine/acylcarnitine translocase (CACT) gene." Iacobazzi V., Naglieri M.A., Stanley C.A., Wanders R.J.A., Palmieri F. Biochem. Biophys. Res. Commun. 252:770-774 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Otud7b (NM_001025613) Mouse Tagged ORF Clone
MR214175 10 µg

Otud7b (NM_001025613) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Hirudin (55-65) (desulfated)
H4080-01B 1 mg

Hirudin (55-65) (desulfated)

Sign In for Pricing
View Details
(E) -β-Farnesene
HY-N7364-01 100 mg

(E) -β-Farnesene

Sign In for Pricing
View Details
(E) -β-Farnesene
HY-N7364-02 10 mM - 1 mL

(E) -β-Farnesene

Sign In for Pricing
View Details
(E) -β-Farnesene
HY-N7364-03 250 mg

(E) -β-Farnesene

Sign In for Pricing
View Details
(E) -β-Farnesene
HY-N7364-04 500 mg

(E) -β-Farnesene

Sign In for Pricing
View Details