Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear transport factor 2 (NUTF2)

Product Specifications

Product Name Alternative

Placental protein 15

Abbreviation

Recombinant Human NUTF2 protein

Gene Name

NUTF2

UniProt

P61970

Expression Region

1-127aa

Organism

Homo sapiens (Human)

Target Sequence

MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.

Molecular Weight

41.5 kDa

References & Citations

"Identification of NTF2, a cytosolic factor for nuclear import that interacts with nuclear pore complex protein p62." Paschal B.M., Gerace L. J. Cell Biol. 129:925-937 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD163 Mouse Monoclonal Antibody [Clone ID: LBI3C1]
AMM13825VCF 100 µg

CD163 Mouse Monoclonal Antibody [Clone ID: LBI3C1]

Ask
View Details
Uap1 (NM_133806) Mouse Tagged ORF Clone Lentiviral Particle
MR208342L4V 200 µL

Uap1 (NM_133806) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human ZNF557 siRNA
abx940887-01 15 nmol

Human ZNF557 siRNA

Ask
View Details
Human ZNF557 siRNA
abx940887-02 30 nmol

Human ZNF557 siRNA

Ask
View Details
Elab Fluor® Violet 610 Anti-Human CD16 Antibody[3G8]
E-AB-F1236T-01 20 Tests

Elab Fluor® Violet 610 Anti-Human CD16 Antibody[3G8]

Ask
View Details
Elab Fluor® Violet 610 Anti-Human CD16 Antibody[3G8]
E-AB-F1236T-02 100 Tests

Elab Fluor® Violet 610 Anti-Human CD16 Antibody[3G8]

Ask
View Details