Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C19orf48 (C19orf48)

Product Specifications

Product Name Alternative

Multidrug resistance-related protein

Abbreviation

Recombinant Human C19orf48 protein

Gene Name

C19orf48

UniProt

Q6RUI8

Expression Region

1-117aa

Organism

Homo sapiens (Human)

Target Sequence

MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.1 kDa

References & Citations

"[Cloning and sequence analysis of a new, full-length cDNA fragment of drug resistance-related gene in human lung adenocarcinoma]." Zhou X.D., Liu L.Z., Qian G.S., Huang G.J., Chen J. Ai Zheng 21:341-345 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pm20d1 shRNA (UAS) - Lentiviral mouse Pm20d1 shRNA (UAS, RFP) (25)
GTR15170639 1 Vial

Lentiviral mouse Pm20d1 shRNA (UAS) - Lentiviral mouse Pm20d1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Pstpip2 Mouse shRNA Plasmid (Locus ID 19201)
TL501771 1 Kit

Pstpip2 Mouse shRNA Plasmid (Locus ID 19201)

Sign In for Pricing
View Details
EphA2 Antibody
N0221-01 50 µL

EphA2 Antibody

Sign In for Pricing
View Details
EphA2 Antibody
N0221-02 100 µL

EphA2 Antibody

Sign In for Pricing
View Details
EphA2 Antibody
N0221-03 200 µL

EphA2 Antibody

Sign In for Pricing
View Details
Prl5a1 AAV Vector (Rat) (CMV)
37689106 1 µg

Prl5a1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details