Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor suppressor candidate 2 (TUSC2)

Product Specifications

Product Name Alternative

Fusion 1 protein

Abbreviation

Recombinant Human TUSC2 protein

Gene Name

TUSC2

UniProt

O75896

Expression Region

1-110aa

Organism

Homo sapiens (Human)

Target Sequence

GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.

Molecular Weight

38.9 kDa

References & Citations

"Overexpression of candidate tumor suppressor gene FUS1 isolated from the 3p21.3 homozygous deletion region leads to G1 arrest and growth inhibition of lung cancer cells." Kondo M., Ji L., Kamibayashi C., Tomizawa Y., Randle D., Sekido Y., Yokota J., Kashuba V., Zabarovsky E., Kuzmin I., Lerman M., Roth J., Minna J.D. Oncogene 20:6258-6262 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A3 (NM_002960) Human Over-expression Lysate
LY418990 100 µg

S100A3 (NM_002960) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Glypican 1 / GPC1 (S486A, S488A, S490A) Protein, His Tag (MALS verified)
GP1-H52H8-100ug 100 µg

Human Glypican 1 / GPC1 (S486A, S488A, S490A) Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
Calcein Orange™ sodium salt
22008-AAT 1 mg

Calcein Orange™ sodium salt

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF647 conjugate, 0.1mg/mL
BNC470287-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-ZNF34
Y058905 100 µg

Anti-ZNF34

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS805919 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details