Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spindlin-1 (SPIN1)

Product Specifications

Product Name Alternative

Ovarian cancer-related protein Spindlin1

Abbreviation

Recombinant Human SPIN1 protein

Gene Name

SPIN1

UniProt

Q9Y657

Expression Region

1-262aa

Organism

Homo sapiens (Human)

Target Sequence

MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway. Overexpression induces metaphase arrest and chromosomal instability. Localizes to active rDNA loci and promotes the expression of rRNA genes. May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway

Molecular Weight

56.6 kDa

References & Citations

"Spindlin1, a novel nuclear protein with a role in the transformation of NIH3T3 cells." Gao Y., Yue W., Zhang P., Li L., Xie X., Yuan H., Chen L., Liu D., Yan F., Pei X. Biochem. Biophys. Res. Commun. 335:343-350 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TIMP1 Human Gene Knockout Kit (CRISPR)
KN401548 1 Kit

TIMP1 Human Gene Knockout Kit (CRISPR)

Ask
View Details
Rabbit anti-14-3-3 gamma Antibody
YLD0005-01 50 µL

Rabbit anti-14-3-3 gamma Antibody

Ask
View Details
Rabbit anti-14-3-3 gamma Antibody
YLD0005-02 100 µL

Rabbit anti-14-3-3 gamma Antibody

Ask
View Details
Canine Centromere protein R (ITGB3BP) ELISA Kit
MBS7251228-01 48 Well

Canine Centromere protein R (ITGB3BP) ELISA Kit

Ask
View Details
Canine Centromere protein R (ITGB3BP) ELISA Kit
MBS7251228-02 96 Well

Canine Centromere protein R (ITGB3BP) ELISA Kit

Ask
View Details
Canine Centromere protein R (ITGB3BP) ELISA Kit
MBS7251228-03 5x 96 Well

Canine Centromere protein R (ITGB3BP) ELISA Kit

Ask
View Details