Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5)

Product Specifications

Product Name Alternative

Hepatitis B virus X-interacting protein

Abbreviation

Recombinant Human HBXIP protein

Gene Name

HBXIP

UniProt

O43504

Expression Region

1-91aa

Organism

Homo sapiens (Human)

Target Sequence

MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication.

Molecular Weight

36.6 kDa

References & Citations

"Cloning and characterization of a novel hepatitis B virus x binding protein that inhibits viral replication." Melegari M., Scaglioni P.P., Wands J.R. J. Virol. 72:1737-1743 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RGS11 Protein Lysate (Human) with C-Ha Tag
39468031 100 μg

RGS11 Protein Lysate (Human) with C-Ha Tag

Ask
View Details
Bovine Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) ELISA Kit
RDR-TIMP1-b-01 96 Tests

Bovine Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) ELISA Kit

Ask
View Details
Bovine Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) ELISA Kit
RDR-TIMP1-b-02 48 Tests

Bovine Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) ELISA Kit

Ask
View Details
PCDH17 (NM_001040429) Human Mass Spec Standard
PH306968 10 µg

PCDH17 (NM_001040429) Human Mass Spec Standard

Ask
View Details
Anti-Mouse IL17RE Polyclonal Antibody
PMJ25801 100 μg

Anti-Mouse IL17RE Polyclonal Antibody

Ask
View Details