Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Maleylacetoacetate isomerase (GSTZ1)

Product Specifications

Product Name Alternative

GSTZ1-1 Glutathione S-transferase zeta 1 (EC:2.5.1.18)

Abbreviation

Recombinant Human GSTZ1 protein

Gene Name

GSTZ1

UniProt

O43708

Expression Region

1-216aa

Organism

Homo sapiens (Human)

Target Sequence

MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid.

Molecular Weight

51.1 kDa

References & Citations

"Characterization of a fungal maleylacetoacetate isomerase gene and identification of its human homologue." Fernandez-Canon J.M., Penalva M.A. J. Biol. Chem. 273:329-337 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of BC001453

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX1 Rabbit mAb
MBS9469884-01 0.05 mL

COX1 Rabbit mAb

Sign In for Pricing
View Details
COX1 Rabbit mAb
MBS9469884-02 0.1 mL

COX1 Rabbit mAb

Sign In for Pricing
View Details
COX1 Rabbit mAb
MBS9469884-03 5x 0.1 mL

COX1 Rabbit mAb

Sign In for Pricing
View Details
Mi-Saponin A
MF-0024088-01 1 mg

Mi-Saponin A

Sign In for Pricing
View Details
Mi-Saponin A
MF-0024088-02 5 mg

Mi-Saponin A

Sign In for Pricing
View Details
ERCC5 antibody
70R-17135 50 ul

ERCC5 antibody

Sign In for Pricing
View Details