Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF)

Product Specifications

Product Name Alternative

Small integral membrane protein of lysosome/late endosome p53-induced gene 7 protein

Abbreviation

Recombinant Human LITAF protein

Gene Name

LITAF

UniProt

Q99732

Expression Region

1-161aa

Organism

Homo sapiens (Human)

Target Sequence

MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2/MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF-alpha) gene expression.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation

Molecular Weight

44.1 kDa

References & Citations

"A novel lipopolysaccharide-induced transcription factor regulating tumor necrosis factor alpha gene expression: molecular cloning, sequencing, characterization, and chromosomal assignment." Myokai F., Takashiba S., Lebo R., Amar S. Proc. Natl. Acad. Sci. U.S.A. 96:4518-4523 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Stomach
CS503812 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
TGFBI Recombinant Rabbit Monoclonal Antibody [JM24-53]
ET1705-29 100 µL

TGFBI Recombinant Rabbit Monoclonal Antibody [JM24-53]

Sign In for Pricing
View Details
KIAA1276 (FAM184B) (NM_015688) Human Over-expression Lysate
LC429468 20 µg

KIAA1276 (FAM184B) (NM_015688) Human Over-expression Lysate

Sign In for Pricing
View Details
Tal1 (BTL73), CF740 conjugate, 0.1mg/mL
BNC742852-100 1x 100 µL

Tal1 (BTL73), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS806401 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
PSMA1 Antibody
KC-2719-01 50 μL

PSMA1 Antibody

Sign In for Pricing
View Details