Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteasome subunit beta type-10 (PSMB10)

Product Specifications

Product Name Alternative

Low molecular mass protein 10 Macropain subunit MECl-1 Multicatalytic endopeptidase complex subunit MECl-1 Proteasome MECl-1 Proteasome subunit beta-2i

Abbreviation

Recombinant Human PSMB10 protein

Gene Name

PSMB10

UniProt

P40306

Expression Region

1-273aa

Organism

Homo sapiens (Human)

Target Sequence

MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.

Molecular Weight

51.6 kDa

References & Citations

"A tight cluster of five unrelated human genes on chromosome 16q22.1." Larsen F., Solheim J., Kristensen T., Kolstoe A.-B., Prydz H. Hum. Mol. Genet. 2:1589-1595 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823E-01 25 µg

APC Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
APC Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823E-02 100 µg

APC Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Bovine IgG,
AA-2351-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Bovine IgG,

Sign In for Pricing
View Details
Dnmt1 Recombinant Rabbit monoclonal Antibody
HA750359 100 µL

Dnmt1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Nonadecanoic-d37 Acid
TRC-N649201-25MG 25 mg

Nonadecanoic-d37 Acid

Sign In for Pricing
View Details
4-Vinylbenzoic Acid
TRC-V371000-25G 25 g

4-Vinylbenzoic Acid

Sign In for Pricing
View Details