Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteasome activator complex subunit 1 (PSME1)

Product Specifications

Product Name Alternative

11S regulator complex subunit alpha

Abbreviation

Recombinant Human PSME1 protein

Gene Name

PSME1

UniProt

Q06323

Expression Region

1-249aa

Organism

Homo sapiens (Human)

Target Sequence

MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.

Molecular Weight

55.7 kDa

References & Citations

"Interferon-gamma up-regulates a unique set of proteins in human keratinocytes. Molecular cloning and expression of the cDNA encoding the RGD-sequence-containing protein IGUP I-5111." Honore B., Leffers H., Madsen P., Celis J.E. Eur. J. Biochem. 218:421-430 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STNL P010-600x200-PP-CRD/1 AC Signs
823087 Card of 1 Pictogram(s)

STNL P010-600x200-PP-CRD/1 AC Signs

Sign In for Pricing
View Details
Recombinant Mouse VSTM5 Protein, N-GST & C-His
E55P6839 50 µg

Recombinant Mouse VSTM5 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Elongation factor Tu (tuf)
MBS1036068-01 0.02 mg (E-Coli)

Recombinant Salinispora arenicola Elongation factor Tu (tuf)

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Elongation factor Tu (tuf)
MBS1036068-02 0.02 mg (Yeast)

Recombinant Salinispora arenicola Elongation factor Tu (tuf)

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Elongation factor Tu (tuf)
MBS1036068-03 0.1 mg (E-Coli)

Recombinant Salinispora arenicola Elongation factor Tu (tuf)

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Elongation factor Tu (tuf)
MBS1036068-04 0.1 mg (Yeast)

Recombinant Salinispora arenicola Elongation factor Tu (tuf)

Sign In for Pricing
View Details