Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prohibitin-2 (PHB2)

Product Specifications

Product Name Alternative

B-cell receptor-associated protein BAP37 D-prohibitin Repressor of estrogen receptor activity

Abbreviation

Recombinant Human PHB2 protein

Gene Name

PHB2

UniProt

Q99623

Expression Region

1-299aa

Organism

Homo sapiens (Human)

Target Sequence

MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER) -selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity) . Functions as an estrogen receptor (ER) -selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging.

Molecular Weight

60.2 kDa

References & Citations

"Large-scale sequencing in human chromosome 12p13: experimental and computational gene structure determination." Ansari-Lari M.A., Shen Y., Muzny D.M., Lee W., Gibbs R.A. Genome Res. 7:268-280 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)
MBS2080826-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)
MBS2080826-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)
MBS2080826-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)
MBS2080826-04 1 mL

Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)
MBS2080826-05 5 mL

Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)
MBS2080826-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Fructosamine-3-Kinase (FN3K)

Sign In for Pricing
View Details