Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim21 (TIMM21)

Product Specifications

Product Name Alternative

TIM21-like protein, mitochondrial

Abbreviation

Recombinant Human TIMM21 protein

Gene Name

TIMM21

UniProt

Q9BVV7

Expression Region

1-248aa

Organism

Homo sapiens (Human)

Target Sequence

MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes.

Molecular Weight

55.2 kDa

References & Citations

"Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)
MBS1471096-01 0.02 mg (E-Coli)

Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)

Ask
View Details
Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)
MBS1471096-02 0.02 mg (Yeast)

Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)

Ask
View Details
Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)
MBS1471096-03 0.1 mg (E-Coli)

Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)

Ask
View Details
Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)
MBS1471096-04 0.1 mg (Yeast)

Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)

Ask
View Details
Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)
MBS1471096-05 0.02 mg (Baculovirus)

Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)

Ask
View Details
Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)
MBS1471096-06 0.02 mg (Mammalian-Cell)

Recombinant Nitrosococcus oceani Histidinol-phosphate aminotransferase 2 (hisC2)

Ask
View Details