Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pre-mRNA-splicing factor SPF27 (BCAS2)

Product Specifications

Product Name Alternative

Breast carcinoma-amplified sequence 2 DNA amplified in mammary carcinoma 1 protein Spliceosome-associated protein SPF 27

Abbreviation

Recombinant Human BCAS2 protein

Gene Name

BCAS2

UniProt

O75934

Expression Region

1-225aa

Organism

Homo sapiens (Human)

Target Sequence

AGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR) .

Molecular Weight

53.0 kDa

References & Citations

"Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex." Neubauer G., King A., Rappsilber J., Calvio C., Watson M., Ajuh P., Sleeman J., Lamond A.I., Mann M. Nat. Genet. 20:46-50 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL22 Antibody Picoband® Fluoro594 Conjugated
A00963-3-Fluoro594 100 µg/Vial

Anti-IL22 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
I-138
E1479-1g 1 g

I-138

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0346 protein SPP_0954 (SPP_0954)
MBS1192322-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae UPF0346 protein SPP_0954 (SPP_0954)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0346 protein SPP_0954 (SPP_0954)
MBS1192322-02 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae UPF0346 protein SPP_0954 (SPP_0954)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0346 protein SPP_0954 (SPP_0954)
MBS1192322-03 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae UPF0346 protein SPP_0954 (SPP_0954)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0346 protein SPP_0954 (SPP_0954)
MBS1192322-04 0.1 mg (Yeast)

Recombinant Streptococcus pneumoniae UPF0346 protein SPP_0954 (SPP_0954)

Sign In for Pricing
View Details