Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human F-actin-capping protein subunit beta (CAPZB)

Product Specifications

Product Name Alternative

CapZ beta

Abbreviation

Recombinant Human CAPZB protein

Gene Name

CAPZB

UniProt

P47756

Expression Region

1-272aa

Organism

Homo sapiens (Human)

Target Sequence

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

F-actin-capping proteins bind in a Ca (2+) -independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.

Molecular Weight

57.6 kDa

References & Citations

"Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cystathionine Gamma Lyase (CSE) ELISA Kit
RD-CSE-Hu-01 96 Tests

Human Cystathionine Gamma Lyase (CSE) ELISA Kit

Sign In for Pricing
View Details
Human Cystathionine Gamma Lyase (CSE) ELISA Kit
RD-CSE-Hu-02 48 Tests

Human Cystathionine Gamma Lyase (CSE) ELISA Kit

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), 1mg/mL
BNUM1921-50 1x 50 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), 1mg/mL

Sign In for Pricing
View Details
Magnetic Stirrer BMGS-106
BMGS-106 1 Unit

Magnetic Stirrer BMGS-106

Sign In for Pricing
View Details
11,11'-(2,2'-(Piperazine-1,4-diyl)bis(acetyl))bis(5H-benzo[e]pyrido[3,2-b][1,4]diazepin-6(11H)-one)-d8
TRC-P480147-1MG 1 mg

11,11'-(2,2'-(Piperazine-1,4-diyl)bis(acetyl))bis(5H-benzo[e]pyrido[3,2-b][1,4]diazepin-6(11H)-one)-d8

Sign In for Pricing
View Details
MRPL32 (NM_031903) Human Recombinant Protein
TP304559L 1 mg

MRPL32 (NM_031903) Human Recombinant Protein

Sign In for Pricing
View Details