Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human F-actin-capping protein subunit beta (CAPZB)

Product Specifications

Product Name Alternative

CapZ beta

Abbreviation

Recombinant Human CAPZB protein

Gene Name

CAPZB

UniProt

P47756

Expression Region

1-272aa

Organism

Homo sapiens (Human)

Target Sequence

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

F-actin-capping proteins bind in a Ca (2+) -independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.

Molecular Weight

57.6 kDa

References & Citations

"Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Estr-4-en-17-one
TRC-E889085-5MG 5 mg

Estr-4-en-17-one

Sign In for Pricing
View Details
COASY (NM_025233) Human Over-expression Lysate
LC403068 20 µg

COASY (NM_025233) Human Over-expression Lysate

Sign In for Pricing
View Details
Camptothecin
6209 100 mg

Camptothecin

Sign In for Pricing
View Details
Beta Amyloid 1-42 Recombinant Rabbit monoclonal Antibody
HA751103 100 µL

Beta Amyloid 1-42 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CHST11 (NM_001173982) Human Over-expression Lysate
LY432922 100 µg

CHST11 (NM_001173982) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human G-CSF protein (His Tag)
PKSH034164-01 20 µg

Recombinant Human G-CSF protein (His Tag)

Sign In for Pricing
View Details