What is the catalog number for Recombinant Human Protein boule-like (BOLL)?

The catalog number for Recombinant Human Protein boule-like (BOLL) is CSB-EP854082HU.

What sizes are available for Recombinant Human Protein boule-like (BOLL)?

Recombinant Human Protein boule-like (BOLL) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Protein boule-like (BOLL) come in?

Recombinant Human Protein boule-like (BOLL) is available in 3 different pack sizes.

Is Recombinant Human Protein boule-like (BOLL) in stock?

Recombinant Human Protein boule-like (BOLL) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Protein boule-like (BOLL)?

Recombinant Human Protein boule-like (BOLL) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Protein boule-like (BOLL)?

Estimated delivery time for Recombinant Human Protein boule-like (BOLL) is approximately 15 business day(s), depending on your location.

Recombinant Human Protein boule-like (BOLL)

Product Specifications

Product Name Alternative

Bol (Drosophila boule homolog) like; Bol; Bol boule like; Bol, boule like (Drosophila) ; bol, boule-like (Drosophila) ; Boll; BOLL_HUMAN; BOULE; Boule like; BOULE, Drosophila, homolog of; Protein boule like; Protein boule-like; Putative uncharacterized protein BOLL

Abbreviation

Recombinant Human BOLL protein

Gene Name

BOLL

UniProt

Q8N9W6

Expression Region

1-283aa

Organism

Homo sapiens (Human)

Target Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation (By similarity) .

Molecular Weight

58.3 kDa

References & Citations

"A gene family required for human germ cell development evolved from an ancient meiotic gene conserved in metazoans." Xu E.Y., Moore F.L., Reijo Pera R.A. Proc. Natl. Acad. Sci. U.S.A. 98:7414-7419 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.