Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein boule-like (BOLL)

Product Specifications

Product Name Alternative

Bol (Drosophila boule homolog) like; Bol; Bol boule like; Bol, boule like (Drosophila) ; bol, boule-like (Drosophila) ; Boll; BOLL_HUMAN; BOULE; Boule like; BOULE, Drosophila, homolog of; Protein boule like; Protein boule-like; Putative uncharacterized protein BOLL

Abbreviation

Recombinant Human BOLL protein

Gene Name

BOLL

UniProt

Q8N9W6

Expression Region

1-283aa

Organism

Homo sapiens (Human)

Target Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation (By similarity) .

Molecular Weight

58.3 kDa

References & Citations

"A gene family required for human germ cell development evolved from an ancient meiotic gene conserved in metazoans." Xu E.Y., Moore F.L., Reijo Pera R.A. Proc. Natl. Acad. Sci. U.S.A. 98:7414-7419 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Drosophila melanogaster (Fruit fly) Snup Polyclonal Antibody
MBS9017256 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) Snup Polyclonal Antibody

Sign In for Pricing
View Details
NAA25 ORF Vector (Human) (pORF)
31370011 1.0 µg DNA

NAA25 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Tau (microtubule-associated protein tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, Microtubule-associated protein tau, MSTD, MTBT1, MTBT2, Neurofibrillary tangle protein, Paired helical filament-tau, PHF-tau, PPND, tau, TAU) (AP)
MBS6241931-01 0.1 mL

Tau (microtubule-associated protein tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, Microtubule-associated protein tau, MSTD, MTBT1, MTBT2, Neurofibrillary tangle protein, Paired helical filament-tau, PHF-tau, PPND, tau, TAU) (AP)

Sign In for Pricing
View Details
Tau (microtubule-associated protein tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, Microtubule-associated protein tau, MSTD, MTBT1, MTBT2, Neurofibrillary tangle protein, Paired helical filament-tau, PHF-tau, PPND, tau, TAU) (AP)
MBS6241931-02 5x 0.1 mL

Tau (microtubule-associated protein tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, Microtubule-associated protein tau, MSTD, MTBT1, MTBT2, Neurofibrillary tangle protein, Paired helical filament-tau, PHF-tau, PPND, tau, TAU) (AP)

Sign In for Pricing
View Details
PRMT6 Rabbit mAb
AB100980 100 µL

PRMT6 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Follicle Stimulating Hormone Beta (FSHb)
MBS2124581-01 0.01 mg

Recombinant Follicle Stimulating Hormone Beta (FSHb)

Sign In for Pricing
View Details