Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TGFB1-induced anti-apoptotic factor 1 (TIAF1)

Product Specifications

Product Name Alternative

12KDA TGF-beta-1-induced antiapoptotic factor

Abbreviation

Recombinant Human TIAF1 protein

Gene Name

TIAF1

UniProt

O95411

Expression Region

1-115aa

Organism

Homo sapiens (Human)

Target Sequence

MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.

Molecular Weight

39.4 kDa

References & Citations

"High expression of TIAF-1 in chronic kidney and liver allograft rejection and in activated T-helper cells." van der Leij J., van den Berg A., Albrecht E.W., Blokzijl T., Roozendaal R., Gouw A.S., de Jong K.P., Stegeman C.A., van Goor H., Chang N.S., Poppema S. Transplantation 75:2076-2082 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF488A conjugate, 0.1mg/mL
BNC880764-100 1x 100 µL

CD79a (IGA/764), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1042), CF488A conjugate, 0.1mg/mL
BNC881042-100 1x 100 µL

TRIM29 (TRIM29/1042), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF740 conjugate, 0.1mg/mL
BNC740948-100 1x 100 µL

Cytokeratin 5/8 (C-50), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details