Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)

Product Specifications

Product Name Alternative

DARPP-32 Dopamine- and cAMP-regulated neuronal phosphoprotein

Abbreviation

Recombinant Human PPP1R1B protein

Gene Name

PPP1R1B

UniProt

Q9UD71

Expression Region

1-168aa

Organism

Homo sapiens (Human)

Target Sequence

MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Inhibitor of protein-phosphatase 1.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibitor of protein-phosphatase 1.

Molecular Weight

45.7 kDa

References & Citations

"Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue." Brene S., Lindefors N., Ehrlich M., Taubes T., Horiuchi A., Kopp J., Hall H., Sedvall G., Greengard P., Persson H. J. Neurosci. 14:985-998 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant S100 Calcium Binding Protein B (S100B)
MBS2011650-01 0.01 mg

Recombinant S100 Calcium Binding Protein B (S100B)

Sign In for Pricing
View Details
Recombinant S100 Calcium Binding Protein B (S100B)
MBS2011650-02 0.05 mg

Recombinant S100 Calcium Binding Protein B (S100B)

Sign In for Pricing
View Details
Recombinant S100 Calcium Binding Protein B (S100B)
MBS2011650-03 0.1 mg

Recombinant S100 Calcium Binding Protein B (S100B)

Sign In for Pricing
View Details
Recombinant S100 Calcium Binding Protein B (S100B)
MBS2011650-04 0.2 mg

Recombinant S100 Calcium Binding Protein B (S100B)

Sign In for Pricing
View Details
Recombinant S100 Calcium Binding Protein B (S100B)
MBS2011650-05 0.5 mg

Recombinant S100 Calcium Binding Protein B (S100B)

Sign In for Pricing
View Details
Recombinant S100 Calcium Binding Protein B (S100B)
MBS2011650-06 1 mg

Recombinant S100 Calcium Binding Protein B (S100B)

Sign In for Pricing
View Details