Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ragulator complex protein LAMTOR3 (LAMTOR3)

Product Specifications

Product Name Alternative

Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3

Abbreviation

Recombinant Human LAMTOR3 protein

Gene Name

LAMTOR3

UniProt

Q9UHA4

Expression Region

1-124aa

Organism

Homo sapiens (Human)

Target Sequence

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.

Molecular Weight

40.6 kDa

References & Citations

"Novel genes expressed in human dendritic cells." Li Y., Huang C., Ren S., Tu Y., Gu W., Wang Y., Han Z., Chen Z. Submitted (NOV-1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiscoveryProbe™ Neuronal Signaling Library
L1026-.1 100 µL/Well (10 mM Solution) - 96 Well Racks With Screw Cap

DiscoveryProbe™ Neuronal Signaling Library

Sign In for Pricing
View Details
Potassium Pyroantimonate 98.5% Extrapure
02167 00100 100 g

Potassium Pyroantimonate 98.5% Extrapure

Sign In for Pricing
View Details
Recombinant Human LOXL1 Protein, N-His
AP92108 50 µg

Recombinant Human LOXL1 Protein, N-His

Sign In for Pricing
View Details
ITGB8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1105808 1.0 µg DNA

ITGB8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Human Protein Phosphatase 1G/PP1MG Protein (C-6His)
ARP5443-01 10 µg

Recombinant Human Protein Phosphatase 1G/PP1MG Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human Protein Phosphatase 1G/PP1MG Protein (C-6His)
ARP5443-02 50 µg

Recombinant Human Protein Phosphatase 1G/PP1MG Protein (C-6His)

Sign In for Pricing
View Details