Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heat shock protein beta-2 (HSPB2)

Product Specifications

Product Name Alternative

DMPK-binding protein

Abbreviation

Recombinant Human HSPB2 protein

Gene Name

HSPB2

UniProt

Q16082

Expression Region

1-182aa

Organism

Homo sapiens (Human)

Target Sequence

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May regulate the kinase DMPK.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May regulate the kinase DMPK.

Molecular Weight

47.2 kDa

References & Citations

"Identification and characterization of the gene encoding a new member of the alpha-crystallin/small hsp family, closely linked to the alphaB-crystallin gene in a head-to-head manner." Iwaki A., Nagano T., Nakagawa M., Iwaki T., Fukumaki Y. Genomics 45:386-394 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA8A ORF Vector (Human) (pORF)
ORF020294 1.0 µg DNA

GOLGA8A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rat Zcchc12 Pre-designed siRNA Set B
SI216209B 1 Each

Rat Zcchc12 Pre-designed siRNA Set B

Sign In for Pricing
View Details
NOL4 (NM_001198549) Human Tagged Lenti ORF Clone
RC231179L4 10 µg

NOL4 (NM_001198549) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Tissue Factor Rabbit Monoclonal Antibody
MA5445-.1 100 µL

Anti-Tissue Factor Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-Tau (Thr548) Polyclonal Antibody
TMAB-11363-01 50 μL

Anti-Phospho-Tau (Thr548) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-Tau (Thr548) Polyclonal Antibody
TMAB-11363-02 100 µL

Anti-Phospho-Tau (Thr548) Polyclonal Antibody

Sign In for Pricing
View Details