Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Appetite-regulating hormone (GHRL)

Product Specifications

Product Name Alternative

Growth hormone secretagogue Growth hormone-releasing peptide Motilin-related peptide Protein M46

Abbreviation

Recombinant Human GHRL protein

Gene Name

GHRL

UniProt

Q9UBU3

Expression Region

1-117aa

Organism

Homo sapiens (Human)

Target Sequence

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR) . Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation. Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR) . Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.; FUNCTION

Molecular Weight

39.9 kDa

References & Citations

"Ghrelin is a growth-hormone-releasing acylated peptide from stomach." Kojima M., Hosoda H., Date Y., Nakazato M., Matsuo H., Kangawa K. Nature 402:656-660 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGA6 Polyclonal Antibody
MBS8530953-01 0.1 mg

MAGA6 Polyclonal Antibody

Sign In for Pricing
View Details
MAGA6 Polyclonal Antibody
MBS8530953-02 0.1 mL (AF635)

MAGA6 Polyclonal Antibody

Sign In for Pricing
View Details
MAGA6 Polyclonal Antibody
MBS8530953-03 0.1 mL (AF610)

MAGA6 Polyclonal Antibody

Sign In for Pricing
View Details
MAGA6 Polyclonal Antibody
MBS8530953-04 0.1 mL (AF405S)

MAGA6 Polyclonal Antibody

Sign In for Pricing
View Details
MAGA6 Polyclonal Antibody
MBS8530953-05 0.1 mL (AF405L)

MAGA6 Polyclonal Antibody

Sign In for Pricing
View Details
MAGA6 Polyclonal Antibody
MBS8530953-06 0.1 mL (AF546)

MAGA6 Polyclonal Antibody

Sign In for Pricing
View Details