Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytosolic beta-glucosidase (GBA3)

Product Specifications

Product Name Alternative

Cytosolic beta-glucosidase-like protein 1

Abbreviation

Recombinant Human GBA3 protein

Gene Name

GBA3

UniProt

Q9H227

Expression Region

1-162aa

Organism

Homo sapiens (Human)

Target Sequence

MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Glycosidase probably involved in the intestinal absorption and metabolism of dietary flavonoid glycosides. Able to hydrolyze a broad variety of glycosides including phytoestrogens, flavonols, flavones, flavanones and cyanogens. Possesses beta-glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Glycosidase probably involved in the intestinal absorption and metabolism of dietary flavonoid glycosides. Able to hydrolyze a broad variety of glycosides including phytoestrogens, flavonols, flavones, flavanones and cyanogens. Possesses beta-glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide.

Molecular Weight

45.3 kDa

References & Citations

"Functional expression of human liver cytosolic beta-glucosidase in Pichia pastoris. Insights into its role in the metabolism of dietary glucosides." Berrin J.-G., McLauchlan W.R., Needs P., Williamson G., Puigserver A., Kroon P.A., Juge N. Eur. J. Biochem. 269:249-258 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCH 51866
HY-116262 1 Each

SCH 51866

Sign In for Pricing
View Details
TCN2 Protein (C-His, Mouse)
P528870 100 µg

TCN2 Protein (C-His, Mouse)

Sign In for Pricing
View Details
Mouse Tmem128 (NM_025480) AAV Particle
MR201289A1V 250 µL

Mouse Tmem128 (NM_025480) AAV Particle

Sign In for Pricing
View Details
MYL12B Rabbit Polyclonal Antibody
TA364790 100 µL

MYL12B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AdmiRa-hsa-miR-24-3p-Off Virus
mh5373 1.0 mL

AdmiRa-hsa-miR-24-3p-Off Virus

Sign In for Pricing
View Details
GLRA4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV650436 1.0 µg DNA

GLRA4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details