Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GTP-binding protein Di-Ras3 (DIRAS3)

Product Specifications

Product Name Alternative

Distinct subgroup of the Ras family member 3 Rho-related GTP-binding protein RhoI

Abbreviation

Recombinant Human DIRAS3 protein

Gene Name

DIRAS3

UniProt

O95661

Expression Region

1-229aa

Organism

Homo sapiens (Human)

Target Sequence

MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

52.8 kDa

References & Citations

"NOEY2 (ARHI), an imprinted putative tumor suppressor gene in ovarian and breast carcinomas." Yu Y.H., Xu F.J., Peng H., Fang X., Zhao S., Li Y., Cuevas B., Kuo W.-L., Gray J.W., Siciliano M., Mills G.B., Bast R.C. Jr. Proc. Natl. Acad. Sci. U.S.A. 96:214-219 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Sulfate Monohydrate
TRC-Z766490-5G 5 g

Zinc Sulfate Monohydrate

Sign In for Pricing
View Details
Human ASGR1 (Asialoglycoprotein Receptor 1) CLIA Kit
E-CL-H0414-01 24 Tests

Human ASGR1 (Asialoglycoprotein Receptor 1) CLIA Kit

Sign In for Pricing
View Details
Human ASGR1 (Asialoglycoprotein Receptor 1) CLIA Kit
E-CL-H0414-02 48 Tests

Human ASGR1 (Asialoglycoprotein Receptor 1) CLIA Kit

Sign In for Pricing
View Details
Human ASGR1 (Asialoglycoprotein Receptor 1) CLIA Kit
E-CL-H0414-03 96 Tests

Human ASGR1 (Asialoglycoprotein Receptor 1) CLIA Kit

Sign In for Pricing
View Details
Ube2v1 (BC003449) Mouse Tagged ORF Clone
MG200994 10 µg

Ube2v1 (BC003449) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
2-[(2-Fluoro-4-nitrophenyl)amino]ethan-1-ol
TRC-F489585-2.5G 2.5 g

2-[(2-Fluoro-4-nitrophenyl)amino]ethan-1-ol

Sign In for Pricing
View Details