Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activating signal cointegrator 1 complex subunit 3 (ASCC3)

Product Specifications

Product Name Alternative

ASC-1 complex subunit p200

Abbreviation

Recombinant Human ASCC3 protein

Gene Name

ASCC3

UniProt

Q8N3C0

Expression Region

1-111aa

Organism

Homo sapiens (Human)

Target Sequence

MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.

Molecular Weight

40 kDa

References & Citations

"The immunodominant antigen recognized by autologous CTL on a human melanoma is generated by a point mutation in a new member of the RNA helicase gene family." Baurain J.-F. Submitted (FEB-1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD37 Mouse Monoclonal Antibody [Clone ID: 2B8]
AM06314SU-N 100 µL

CD37 Mouse Monoclonal Antibody [Clone ID: 2B8]

Sign In for Pricing
View Details
Monobenzyl Phthalate-d4
TRC-M524902-5MG 5 mg

Monobenzyl Phthalate-d4

Sign In for Pricing
View Details
Schizandrol
TRC-S199905-50MG 50 mg

Schizandrol

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS806350 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
CD8 (C8/144B), CF594 conjugate, 0.1mg/mL
BNC940749-100 1x 100 µL

CD8 (C8/144B), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HFE (NM_139006) Human Recombinant Protein
TP319316 20 µg

HFE (NM_139006) Human Recombinant Protein

Sign In for Pricing
View Details