Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aminoacylase-1 (ACY1)

Product Specifications

Product Name Alternative

N-acyl-L-amino-acid amidohydrolase

Abbreviation

Recombinant Human ACY1 protein

Gene Name

ACY1

UniProt

Q03154

Expression Region

1-408aa

Organism

Homo sapiens (Human)

Target Sequence

MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate) .

Molecular Weight

72.9 kDa

References & Citations

"The nucleotide sequence of human aminoacylase-1." Mitta M., Kato I., Tsunasawa S. Biochim. Biophys. Acta 1174:201-203 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CKB (Creatine kinase B-type) ELISA Kit
EKF59190 96 Tests

Human CKB (Creatine kinase B-type) ELISA Kit

Sign In for Pricing
View Details
UNG1 Peptide
MBS152857-01 0.05 mg

UNG1 Peptide

Sign In for Pricing
View Details
UNG1 Peptide
MBS152857-02 5x 0.05 mg

UNG1 Peptide

Sign In for Pricing
View Details
Human IL-12RB1 (Interleukin-12 receptor subunit beta-1 78) ELISA Kit
EH4153 96 Tests

Human IL-12RB1 (Interleukin-12 receptor subunit beta-1 78) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human FAM53C shRNA (UAS) - Lentiviral human FAM53C shRNA (UAS, GFP) (25)
GTR15149648 1 Vial

Lentiviral human FAM53C shRNA (UAS) - Lentiviral human FAM53C shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Gstt1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3001805 3x 1.0 µg

Gstt1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details